Lineage for d2xqwa_ (2xqw A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277270Family a.102.4.4: Complement components [48251] (3 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 1277271Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)
  7. 1277272Species Human (Homo sapiens) [TaxId:9606] [48253] (12 PDB entries)
  8. 1277286Domain d2xqwa_: 2xqw A: [170300]
    automated match to d1c3da_

Details for d2xqwa_

PDB Entry: 2xqw (more details), 2.3 Å

PDB Description: structure of factor h domains 19-20 in complex with complement c3d
PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d2xqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xqwa_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

SCOPe Domain Coordinates for d2xqwa_:

Click to download the PDB-style file with coordinates for d2xqwa_.
(The format of our PDB-style files is described here.)

Timeline for d2xqwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2xqwb_