SCOPe 2.08: Domain d2xqnm1: 2xqn M:1-113

Lineage for d2xqnm1 (2xqn M:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)

6. Protein Enabled [50768] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159215] (2 PDB entries)

8. Domain d2xqnm1: 2xqn M:1-113 [170292]
   Other proteins in same PDB: d2xqnm2
   automated match to d1evha_
   complexed with zn

Details for d2xqnm1

PDB Entry: 2xqn, 2.62 Å

PDB Description: complex of the 2nd and 3rd lim domains of tes with the evh1 domain of mena and the n-terminal domain of actin-like protein arp7a

PDB Compounds: (M:) enabled homolog

SCOPe Domain Sequences for d2xqnm1:

Sequence; same for both SEQRES and ATOM records:

>d2xqnm1 b.55.1.4 (M:1-113) Enabled {Human (Homo sapiens) [TaxId: 9606]}
mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns

Timeline for d2xqnm1:

• d2xqnm1 first appeared in SCOPe 2.01, called d2xqnm_
  
• d2xqnm1 appears in SCOPe 2.07