SCOPe 2.04: Domain d2xqba_: 2xqb A:

Lineage for d2xqba_ (2xqb A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187448] (13 PDB entries)

8. Domain d2xqba_: 2xqb A: [170286]
   Other proteins in same PDB: d2xqbl1, d2xqbl2
   automated match to d2z3qa1
   complexed with so4

Details for d2xqba_

PDB Entry: 2xqb, 2.6 Å

PDB Description: crystal structure of anti-il-15 antibody in complex with human il-15

PDB Compounds: (A:) interleukin 15

SCOPe Domain Sequences for d2xqba_:

Sequence, based on SEQRES records:

>d2xqba_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
dtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfint

Sequence, based on observed residues (ATOM records):

>d2xqba_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqidatlytesdvhpsckvtamkcfllelqvislesgdasihdtv
enliilannslstesgckeceeleeknikeflqsfvhivqmfint

Timeline for d2xqba_:

• d2xqba_ first appeared in SCOPe 2.01
  
• d2xqba_ appears in SCOPe 2.03
  
• d2xqba_ appears in SCOPe 2.05
  
• d2xqba_ appears in the current release, SCOPe 2.08