Lineage for d1r69__ (1r69 -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) 
Family a.35.1.2: Phage repressors [47419] (6 proteins) 
Protein 434 C1 repressor, DNA-binding domain [47422] (1 species) Species Bacteriophage 434 (Escherichia coli) [TaxId:10712] [47423] (7 PDB entries) 
Domain d1r69__: 1r69 - [17028]
Details for d1r69__
PDB Entry: 1r69 (more details), 2 Å
PDB Description: structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution
SCOP Domain Sequences for d1r69__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r69__ a.35.1.2 (-) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 (Escherichia coli)}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt
SCOP Domain Coordinates for d1r69__:
Click to download the PDB-style file with coordinates for d1r69__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r69__:
- d1r69__ appears in SCOP 1.57
- d1r69__ appears in the current release, SCOPe 2.08, called d1r69a_
View in 3D