Lineage for d2xogb_ (2xog B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928489Protein automated matches [190061] (7 species)
    not a true protein
  7. 2928492Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2928540Domain d2xogb_: 2xog B: [170258]
    automated match to d1a2wa_
    complexed with sfb

Details for d2xogb_

PDB Entry: 2xog (more details), 1.72 Å

PDB Description: functional and structural analyses of n-acylsulfonamide-linked dinucleoside inhibitors of ribonuclease a
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d2xogb_:

Sequence, based on SEQRES records: (download)

>d2xogb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Sequence, based on observed residues (ATOM records): (download)

>d2xogb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknva
ckngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

SCOPe Domain Coordinates for d2xogb_:

Click to download the PDB-style file with coordinates for d2xogb_.
(The format of our PDB-style files is described here.)

Timeline for d2xogb_: