Lineage for d2xlma_ (2xlm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699788Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2699842Protein automated matches [190363] (5 species)
    not a true protein
  7. 2699843Species Achromobacter xylosoxidans [TaxId:85698] [189489] (29 PDB entries)
  8. 2699864Domain d2xlma_: 2xlm A: [170217]
    automated match to d1e83a_
    complexed with hec, no, so4

Details for d2xlma_

PDB Entry: 2xlm (more details), 1.19 Å

PDB Description: cytochrome c prime from alcaligenes xylosoxidans: ferrous recombinant native with bound no
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d2xlma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xlma_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkkk

SCOPe Domain Coordinates for d2xlma_:

Click to download the PDB-style file with coordinates for d2xlma_.
(The format of our PDB-style files is described here.)

Timeline for d2xlma_: