SCOP 1.69: Domain d1octc2: 1oct C:5-75

Lineage for d1octc2 (1oct C:5-75)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families)

5. Family a.35.1.1: POU-specific domain [47414] (3 proteins)

6. Protein Oct-1 [47415] (1 species)
   canonical 4-helical fold

7. Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)

8. Domain d1octc2: 1oct C:5-75 [17017]
   Other proteins in same PDB: d1octc1

Details for d1octc2

PDB Entry: 1oct, 3 Å

PDB Description: crystal structure of the oct-1 pou domain bound to an octamer site: dna recognition with tethered dna-binding modules

SCOP Domain Sequences for d1octc2:

Sequence; same for both SEQRES and ATOM records:

>d1octc2 a.35.1.1 (C:5-75) Oct-1 {Human (Homo sapiens)}
dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
pllekwlndae

Timeline for d1octc2:

• d1octc2 first appeared (with stable ids) in SCOP 1.55
  
• d1octc2 appears in SCOP 1.67
  
• d1octc2 appears in SCOP 1.71
  
• d1octc2 appears in the current release, SCOPe 2.08