Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (16 species) |
Species Streptococcus suis [TaxId:1307] [101134] (8 PDB entries) |
Domain d2xjol_: 2xjo L: [170169] automated match to d1umng_ complexed with ca, cl, epe, ni |
PDB Entry: 2xjo (more details), 2.1 Å
SCOPe Domain Sequences for d2xjol_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xjol_ a.25.1.1 (L:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]} sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg dsvtndifnvakasiekhiwmlqaelgqapkl
Timeline for d2xjol_: