Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (52 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [189614] (1 PDB entry) |
Domain d2xigc_: 2xig C: [170116] automated match to d1mzba_ complexed with cit, zn |
PDB Entry: 2xig (more details), 1.85 Å
SCOPe Domain Sequences for d2xigc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xigc_ a.4.5.0 (C:) automated matches {Helicobacter pylori [TaxId: 85962]} mkrletlesilerlrmsikknglknskqreevvsvlyrsgthlspeeithsirqkdknts issvyrilnflekenfisvletsksgrryeiaakehhdhiiclhcgkiiefadpeienrq nevvkkyqaklishdmkmfvwckecqeses
Timeline for d2xigc_: