Lineage for d2xe5c_ (2xe5 C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022097Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 3022172Protein automated matches [190289] (7 species)
    not a true protein
  7. 3022190Species Escherichia coli [TaxId:562] [187889] (9 PDB entries)
  8. 3022197Domain d2xe5c_: 2xe5 C: [170056]
    automated match to d1osma_
    complexed with asz, c8e, d10, d12, hex, hp6, oct, oes, so4; mutant

Details for d2xe5c_

PDB Entry: 2xe5 (more details), 2.28 Å

PDB Description: molecular insights into clinically isolated ompc mutants and their role in multi-drug resistance (ompc26)
PDB Compounds: (C:) outer membrane porin c

SCOPe Domain Sequences for d2xe5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xe5c_ f.4.3.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
aeiynkdgnkldlygkveglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
atrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgat
yyfnknmstyvdykinllddnrftrdagintddivalglvyqf

SCOPe Domain Coordinates for d2xe5c_:

Click to download the PDB-style file with coordinates for d2xe5c_.
(The format of our PDB-style files is described here.)

Timeline for d2xe5c_: