SCOPe 2.01: Domain d2xe2c_: 2xe2 C:

Lineage for d2xe2c_ (2xe2 C:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (4 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein automated matches [190289] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187889] (6 PDB entries)

8. Domain d2xe2c_: 2xe2 C: [170051]
   automated match to d1osma_
   complexed with oes; mutant

Details for d2xe2c_

PDB Entry: 2xe2, 2.5 Å

PDB Description: molecular insights into clinically isolated ompc20 mutants and their role in multi-drug resistance

PDB Compounds: (C:) outer membrane porin c

SCOPe Domain Sequences for d2xe2c_:

Sequence; same for both SEQRES and ATOM records:

>d2xe2c_ f.4.3.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
aeiynkdgnkldlygkvdglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi
qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf
mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs
itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn
atrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgat
yyfnknmstyvdykinllddnrftrdagintddivalglvyqf

Timeline for d2xe2c_:

• d2xe2c_ is new in SCOPe 2.01-stable
  
• d2xe2c_ appears in SCOPe 2.02
  
• d2xe2c_ appears in the current release, SCOPe 2.08