Lineage for d2xcmd_ (2xcm D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773837Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773838Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2773941Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 2773942Protein automated matches [191181] (10 species)
    not a true protein
  7. 2773984Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189438] (1 PDB entry)
  8. 2773986Domain d2xcmd_: 2xcm D: [170033]
    Other proteins in same PDB: d2xcma1, d2xcma2, d2xcmb1, d2xcmb2
    automated match to d1rl1a_
    complexed with adp, mg, zn

Details for d2xcmd_

PDB Entry: 2xcm (more details), 2.2 Å

PDB Description: complex of hsp90 n-terminal, sgt1 cs and rar1 chord2 domain
PDB Compounds: (D:) sgt1-like protein

SCOPe Domain Sequences for d2xcmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xcmd_ b.15.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
akyrheyyqkpeevvvtvfakgipkqnvnidfgeqilsvvievpgedayylqprlfgkii
pdkckyevlstkieiclakadiitwaslehgk

SCOPe Domain Coordinates for d2xcmd_:

Click to download the PDB-style file with coordinates for d2xcmd_.
(The format of our PDB-style files is described here.)

Timeline for d2xcmd_: