Class b: All beta proteins [48724] (174 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (2 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [189439] (2 PDB entries) |
Domain d2xcdb_: 2xcd B: [170021] automated match to d1sixa_ complexed with cl, gol, mg, na |
PDB Entry: 2xcd (more details), 1.84 Å
SCOPe Domain Sequences for d2xcdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xcdb_ b.85.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa velvevehl
Timeline for d2xcdb_: