Lineage for d1b0nb_ (1b0n B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212923Fold a.34: SinR repressor dimerisation domain-like [47405] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 212924Superfamily a.34.1: SinR repressor dimerisation domain-like [47406] (1 family) (S)
    intertwined heterodimer of two homologous chains
  5. 212925Family a.34.1.1: SinR repressor dimerisation domain-like [47407] (2 proteins)
  6. 212944Protein SinR repressor (dimerisation domain)-SinI anti-repressor complex [47408] (1 species)
  7. 212945Species Bacillus subtilis [TaxId:1423] [47409] (1 PDB entry)
  8. 212947Domain d1b0nb_: 1b0n B: [17002]
    Other proteins in same PDB: d1b0na2
    complexed with zn

Details for d1b0nb_

PDB Entry: 1b0n (more details), 1.9 Å

PDB Description: sinr protein/sini protein complex

SCOP Domain Sequences for d1b0nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0nb_ a.34.1.1 (B:) SinR repressor (dimerisation domain)-SinI anti-repressor complex {Bacillus subtilis}
feldqewvelmveakeanispeeirkyllln

SCOP Domain Coordinates for d1b0nb_:

Click to download the PDB-style file with coordinates for d1b0nb_.
(The format of our PDB-style files is described here.)

Timeline for d1b0nb_: