Class a: All alpha proteins [46456] (171 folds) |
Fold a.34: SinR repressor dimerisation domain-like [47405] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.34.1: SinR repressor dimerisation domain-like [47406] (1 family) intertwined heterodimer of two homologous chains |
Family a.34.1.1: SinR repressor dimerisation domain-like [47407] (2 proteins) |
Protein SinR repressor (dimerisation domain)-SinI anti-repressor complex [47408] (1 species) |
Species Bacillus subtilis [TaxId:1423] [47409] (1 PDB entry) |
Domain d1b0nb_: 1b0n B: [17002] Other proteins in same PDB: d1b0na2 complexed with zn |
PDB Entry: 1b0n (more details), 1.9 Å
SCOP Domain Sequences for d1b0nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0nb_ a.34.1.1 (B:) SinR repressor (dimerisation domain)-SinI anti-repressor complex {Bacillus subtilis} feldqewvelmveakeanispeeirkyllln
Timeline for d1b0nb_: