SCOPe 2.08: Domain d1b0nb_: 1b0n B:

Lineage for d1b0nb_ (1b0n B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.34: Dimerisation interlock [47405] (4 superfamilies)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.34.1: SinR repressor dimerisation domain-like [47406] (1 family)
   intertwined heterodimer of two homologous chains

5. Family a.34.1.1: SinR repressor dimerisation domain-like [47407] (3 proteins)

6. Protein SinI anti-repressor [88843] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [88844] (1 PDB entry)

8. Domain d1b0nb_: 1b0n B: [17002]
   Other proteins in same PDB: d1b0na1, d1b0na2
   CASP3; complexed with SinR repressor dimerisation domain
   complexed with zn
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1b0nb_

PDB Entry: 1b0n, 1.9 Å

PDB Description: sinr protein/sini protein complex

PDB Compounds: (B:) protein (sini protein)

SCOPe Domain Sequences for d1b0nb_:

Sequence; same for both SEQRES and ATOM records:

>d1b0nb_ a.34.1.1 (B:) SinI anti-repressor {Bacillus subtilis [TaxId: 1423]}
feldqewvelmveakeanispeeirkyllln

Timeline for d1b0nb_:

• d1b0nb_ first appeared (with stable ids) in SCOP 1.55, called d1b0nb1
  
• d1b0nb_ appears in SCOPe 2.07