Lineage for d1ecib_ (1eci B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280550Fold a.33: Ectatomin subunits [47400] (1 superfamily)
    4 helices; bundle, closed, left-handed twist
  4. 280551Superfamily a.33.1: Ectatomin subunits [47401] (1 family) (S)
    disulphide-linked heterodimer of similar alpha-hairpin subunits
  5. 280552Family a.33.1.1: Ectatomin subunits [47402] (2 proteins)
  6. 280556Protein Ectatomin subunit B, EB [88839] (1 species)
  7. 280557Species Ant (Ectatomma tuberculatum), venom [TaxId:39300] [88840] (1 PDB entry)
  8. 280558Domain d1ecib_: 1eci B: [17000]
    Other proteins in same PDB: d1ecia_

Details for d1ecib_

PDB Entry: 1eci (more details)

PDB Description: ectatomin (water solution, nmr 20 structures)

SCOP Domain Sequences for d1ecib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecib_ a.33.1.1 (B:) Ectatomin subunit B, EB {Ant (Ectatomma tuberculatum), venom}
wstivklticptlksmakkcegsiatmikkkcdk

SCOP Domain Coordinates for d1ecib_:

Click to download the PDB-style file with coordinates for d1ecib_.
(The format of our PDB-style files is described here.)

Timeline for d1ecib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ecia_