![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (7 species) |
![]() | Domain d2xbbd_: 2xbb D: [169991] Other proteins in same PDB: d2xbba_, d2xbbb_ automated match to d1aara_ complexed with gol |
PDB Entry: 2xbb (more details), 2.68 Å
SCOPe Domain Sequences for d2xbbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xbbd_ d.15.1.1 (D:) Ubiquitin {Cow (Bos taurus) [TaxId: 9913]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d2xbbd_: