Lineage for d1ecia_ (1eci A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2963Fold a.33: Ectatomin, A & B chains [47400] (1 superfamily)
  4. 2964Superfamily a.33.1: Ectatomin, A & B chains [47401] (1 family) (S)
  5. 2965Family a.33.1.1: Ectatomin, A & B chains [47402] (1 protein)
  6. 2966Protein Ectatomin, A & B chains [47403] (1 species)
  7. 2967Species Ant (Ectatomma tuberculatum), venom [TaxId:39300] [47404] (1 PDB entry)
  8. 2968Domain d1ecia_: 1eci A: [16999]

Details for d1ecia_

PDB Entry: 1eci (more details)

PDB Description: ectatomin (water solution, nmr 20 structures)

SCOP Domain Sequences for d1ecia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecia_ a.33.1.1 (A:) Ectatomin, A & B chains {Ant (Ectatomma tuberculatum), venom}
gvipkkiwetvcptvepwakkcsgdiatyikrecgkl

SCOP Domain Coordinates for d1ecia_:

Click to download the PDB-style file with coordinates for d1ecia_.
(The format of our PDB-style files is described here.)

Timeline for d1ecia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ecib_