SCOPe 2.06: Domain d2xb6c_: 2xb6 C:

Lineage for d2xb6c_ (2xb6 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein automated matches [190380] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189379] (3 PDB entries)

8. Domain d2xb6c_: 2xb6 C: [169984]
   Other proteins in same PDB: d2xb6a1, d2xb6a2, d2xb6b1, d2xb6b2
   automated match to d1c4rg_
   complexed with ca, cl, edo, mes, nag

Details for d2xb6c_

PDB Entry: 2xb6, 2.6 Å

PDB Description: revisited crystal structure of neurexin1beta-neuroligin4 complex

PDB Compounds: (C:) Neurexin-1-beta

SCOPe Domain Sequences for d2xb6c_:

Sequence; same for both SEQRES and ATOM records:

>d2xb6c_ b.29.1.4 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv

Timeline for d2xb6c_:

• d2xb6c_ first appeared in SCOPe 2.01
  
• d2xb6c_ appears in SCOPe 2.05
  
• d2xb6c_ appears in SCOPe 2.07
  
• d2xb6c_ appears in the current release, SCOPe 2.08