Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
Protein automated matches [190380] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189379] (3 PDB entries) |
Domain d2xb6c_: 2xb6 C: [169984] Other proteins in same PDB: d2xb6a1, d2xb6a2, d2xb6b1, d2xb6b2 automated match to d1c4rg_ complexed with ca, cl, edo, mes, nag |
PDB Entry: 2xb6 (more details), 2.6 Å
SCOPe Domain Sequences for d2xb6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xb6c_ b.29.1.4 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv
Timeline for d2xb6c_: