Lineage for d1ytfd1 (1ytf D:5-54)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354879Fold a.32: Transcription factor IIA (TFIIA), alpha-helical domain [47395] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 354880Superfamily a.32.1: Transcription factor IIA (TFIIA), alpha-helical domain [47396] (1 family) (S)
    dimer of non-identical alpha-hairpins
  5. 354881Family a.32.1.1: Transcription factor IIA (TFIIA), alpha-helical domain [47397] (2 proteins)
    heterodimer of two homologous chains
  6. 354888Protein Small chain TOA2, N-terminal domain [88835] (2 species)
  7. 354889Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88836] (2 PDB entries)
  8. 354891Domain d1ytfd1: 1ytf D:5-54 [16998]
    Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfb_, d1ytfc_, d1ytfd2
    protein/DNA complex

Details for d1ytfd1

PDB Entry: 1ytf (more details), 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

SCOP Domain Sequences for d1ytfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytfd1 a.32.1.1 (D:5-54) Small chain TOA2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
gyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkd

SCOP Domain Coordinates for d1ytfd1:

Click to download the PDB-style file with coordinates for d1ytfd1.
(The format of our PDB-style files is described here.)

Timeline for d1ytfd1: