Lineage for d2xa3a_ (2xa3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743732Domain d2xa3a_: 2xa3 A: [169970]
    automated match to d1qd0a_
    complexed with so4

Details for d2xa3a_

PDB Entry: 2xa3 (more details), 1.5 Å

PDB Description: crystal structure of the broadly neutralizing llama vhh d7 and its mode of hiv-1 gp120 interaction
PDB Compounds: (A:) llama heavy chain antibody d7

SCOPe Domain Sequences for d2xa3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xa3a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
avqlqesggglvqaggslrlsctvsartssshdmgwfrqapgkerefvaaiswsggttny
vdsvkgrfdiskdnaknavylqmnslkpedtavyycaakwrplrysdnpsnsdynywgqg
tqvtvss

SCOPe Domain Coordinates for d2xa3a_:

Click to download the PDB-style file with coordinates for d2xa3a_.
(The format of our PDB-style files is described here.)

Timeline for d2xa3a_: