Lineage for d1ytfb1 (1ytf B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152190Fold a.32: Transcription factor IIA (TFIIA), N-terminal domain [47395] (1 superfamily)
  4. 152191Superfamily a.32.1: Transcription factor IIA (TFIIA), N-terminal domain [47396] (1 family) (S)
  5. 152192Family a.32.1.1: Transcription factor IIA (TFIIA), N-terminal domain [47397] (1 protein)
  6. 152193Protein Transcription factor IIA (TFIIA), N-terminal domain [47398] (1 species)
  7. 152194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47399] (1 PDB entry)
  8. 152195Domain d1ytfb1: 1ytf B: [16997]
    Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfc1, d1ytfd2

Details for d1ytfb1

PDB Entry: 1ytf (more details), 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

SCOP Domain Sequences for d1ytfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytfb1 a.32.1.1 (B:) Transcription factor IIA (TFIIA), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
snaeasrvyeiivesvvnevredfenagideqtlqdlkniwqkklt

SCOP Domain Coordinates for d1ytfb1:

Click to download the PDB-style file with coordinates for d1ytfb1.
(The format of our PDB-style files is described here.)

Timeline for d1ytfb1: