SCOPe 2.06: Domain d2x9da1: 2x9d A:2-67

Lineage for d2x9da1 (2x9d A:2-67)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (27 PDB entries)

8. Domain d2x9da1: 2x9d A:2-67 [169968]
   Other proteins in same PDB: d2x9da2
   class d; complex with 4-epi-tetracycline
   protein/DNA complex; complexed with cl, itc

Details for d2x9da1

PDB Entry: 2x9d, 2.34 Å

PDB Description: tet repressor (class d) in complex with iso-7-chlortetracycline

PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2x9da1:

Sequence; same for both SEQRES and ATOM records:

>d2x9da1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d2x9da1:

• d2x9da1 first appeared in SCOPe 2.01
  
• d2x9da1 appears in SCOPe 2.05
  
• d2x9da1 appears in SCOPe 2.07
  
• d2x9da1 appears in the current release, SCOPe 2.08