Lineage for d2x89d_ (2x89 D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1109263Protein automated matches [190374] (1 species)
    not a true protein
  7. 1109264Species Human (Homo sapiens) [TaxId:9606] [187221] (4 PDB entries)
  8. 1109266Domain d2x89d_: 2x89 D: [169939]
    Other proteins in same PDB: d2x89a_, d2x89b_, d2x89c_
    automated match to d1a1mb_

Details for d2x89d_

PDB Entry: 2x89 (more details), 2.16 Å

PDB Description: Structure of the Beta2_microglobulin involved in amyloidogenesis
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d2x89d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x89d_ b.1.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyll
yyteftptekdeyacrvnhvtlsqpkivkwdr

SCOPe Domain Coordinates for d2x89d_:

Click to download the PDB-style file with coordinates for d2x89d_.
(The format of our PDB-style files is described here.)

Timeline for d2x89d_: