SCOPe 2.08: Domain d2x89a1: 2x89 A:6-128

Lineage for d2x89a1 (2x89 A:6-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d2x89a1: 2x89 A:6-128 [169936]
   Other proteins in same PDB: d2x89a2, d2x89b2, d2x89c2, d2x89d1, d2x89d2, d2x89e1, d2x89e2, d2x89f1, d2x89f2, d2x89g1, d2x89g2
   automated match to d1jtoa_

Details for d2x89a1

PDB Entry: 2x89, 2.16 Å

PDB Description: Structure of the Beta2_microglobulin involved in amyloidogenesis

PDB Compounds: (A:) antibody

SCOPe Domain Sequences for d2x89a1:

Sequence; same for both SEQRES and ATOM records:

>d2x89a1 b.1.1.1 (A:6-128) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
esgggsvqaggslrlscaasgytdsrycmawfrqapgkerewvarinsgrdityyadsvk
grftfsqdnakntvylqmdslepedtatyycatdiplrcrdivakggdgfrywgqgtqvt
vss

Timeline for d2x89a1:

• d2x89a1 first appeared in SCOPe 2.01, called d2x89a_
  
• d2x89a1 appears in SCOPe 2.07