SCOPe 2.08: Domain d2x71a_: 2x71 A:

Lineage for d2x71a_ (2x71 A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [188244] (18 PDB entries)

8. Domain d2x71a_: 2x71 A: [169913]
   automated match to d1i2wb_
   complexed with eoh, l4c, so4

Details for d2x71a_

PDB Entry: 2x71, 2.1 Å

PDB Description: structural basis for the interaction of lactivicins with serine beta-lactamases

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2x71a_:

Sequence; same for both SEQRES and ATOM records:

>d2x71a_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmkr
nttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvvkal

Timeline for d2x71a_:

• d2x71a_ first appeared in SCOPe 2.01
  
• d2x71a_ appears in SCOPe 2.07