SCOPe 2.08: Domain d2x4za1: 2x4z A:300-590

Lineage for d2x4za1 (2x4z A:300-590)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)

8. Domain d2x4za1: 2x4z A:300-590 [169879]
   Other proteins in same PDB: d2x4za2
   automated match to d1f3mc_
   complexed with 7kc, gol

Details for d2x4za1

PDB Entry: 2x4z, 2.1 Å

PDB Description: crystal structure of the human p21-activated kinase 4 in complex with pf-03758309

PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d2x4za1:

Sequence; same for both SEQRES and ATOM records:

>d2x4za1 d.144.1.0 (A:300-590) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqqr
rellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqiaa
vclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgtp
ywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknlh
kvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnrt

Timeline for d2x4za1:

• d2x4za1 first appeared in SCOPe 2.01, called d2x4za_
  
• d2x4za1 appears in SCOPe 2.07