SCOPe 2.08: Domain d2x4ka1: 2x4k A:1-61

Lineage for d2x4ka1 (2x4k A:1-61)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [189405] (1 PDB entry)

8. Domain d2x4ka1: 2x4k A:1-61 [169857]
   Other proteins in same PDB: d2x4ka2, d2x4kb2
   automated match to d1bjpa_
   complexed with act, po4, zn

Details for d2x4ka1

PDB Entry: 2x4k, 1.1 Å

PDB Description: crystal structure of sar1376, a putative 4-oxalocrotonate tautomerase from the methicillin-resistant staphylococcus aureus (mrsa)

PDB Compounds: (A:) 4-oxalocrotonate tautomerase

SCOPe Domain Sequences for d2x4ka1:

Sequence; same for both SEQRES and ATOM records:

>d2x4ka1 d.80.1.0 (A:1-61) automated matches {Staphylococcus aureus [TaxId: 1280]}
mmpivnvkllegrsdeqlknlvsevtdavekttganrqaihvvieemkpnhygvagvrks
d

Timeline for d2x4ka1:

• d2x4ka1 first appeared in SCOPe 2.01, called d2x4ka_
  
• d2x4ka1 appears in SCOPe 2.07