Lineage for d2x3fa_ (2x3f A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359851Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1359852Protein automated matches [190459] (31 species)
    not a true protein
  7. 1359979Species Staphylococcus aureus [TaxId:282458] [189403] (1 PDB entry)
  8. 1359980Domain d2x3fa_: 2x3f A: [169847]
    automated match to d1v8fa_
    complexed with apc, so4

Details for d2x3fa_

PDB Entry: 2x3f (more details), 1.95 Å

PDB Description: crystal structure of the methicillin-resistant staphylococcus aureus sar2676, a pantothenate synthetase.
PDB Compounds: (A:) panthothenate synthetase

SCOPe Domain Sequences for d2x3fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x3fa_ c.26.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
tklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditvvsvfvnpl
qfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlegak
rpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivread
glakssrnvylteqerqeavhlskslllaqalyqdgerqskviidkvtqyleshisgrie
evavysypqlveqheitgrifislavkfskarlidniiiga

SCOPe Domain Coordinates for d2x3fa_:

Click to download the PDB-style file with coordinates for d2x3fa_.
(The format of our PDB-style files is described here.)

Timeline for d2x3fa_: