SCOPe 2.08: Domain d2x3fa_: 2x3f A:

Lineage for d2x3fa_ (2x3f A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [189403] (1 PDB entry)

8. Domain d2x3fa_: 2x3f A: [169847]
   automated match to d1v8fa_
   complexed with apc, so4

Details for d2x3fa_

PDB Entry: 2x3f, 1.95 Å

PDB Description: crystal structure of the methicillin-resistant staphylococcus aureus sar2676, a pantothenate synthetase.

PDB Compounds: (A:) panthothenate synthetase

SCOPe Domain Sequences for d2x3fa_:

Sequence; same for both SEQRES and ATOM records:

>d2x3fa_ c.26.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
tklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditvvsvfvnpl
qfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlegak
rpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivread
glakssrnvylteqerqeavhlskslllaqalyqdgerqskviidkvtqyleshisgrie
evavysypqlveqheitgrifislavkfskarlidniiiga

Timeline for d2x3fa_:

• d2x3fa_ first appeared in SCOPe 2.01
  
• d2x3fa_ appears in SCOPe 2.07