Lineage for d2x36d_ (2x36 D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1892409Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1892410Protein automated matches [190826] (17 species)
    not a true protein
  7. 1892469Species Human (Homo sapiens) [TaxId:9606] [189350] (4 PDB entries)
  8. 1892475Domain d2x36d_: 2x36 D: [169837]
    automated match to d1rr9e_

Details for d2x36d_

PDB Entry: 2x36 (more details), 2 Å

PDB Description: structure of the proteolytic domain of the human mitochondrial lon protease
PDB Compounds: (D:) lon protease homolog, mitochondrial

SCOPe Domain Sequences for d2x36d_:

Sequence, based on SEQRES records: (download)

>d2x36d_ d.14.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmkesariayt
faraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlam
tgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehy
reifdiafp

Sequence, based on observed residues (ATOM records): (download)

>d2x36d_ d.14.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tppgvvmglawtamggstlfvetslrdgslevtgqlgevmkesariaytfaraflmqhap
andylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgevsltgkil
pvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreifdiafp

SCOPe Domain Coordinates for d2x36d_:

Click to download the PDB-style file with coordinates for d2x36d_.
(The format of our PDB-style files is described here.)

Timeline for d2x36d_: