SCOPe 2.08: Domain d2x1qa1: 2x1q A:6-127

Lineage for d2x1qa1 (2x1q A:6-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d2x1qa1: 2x1q A:6-127 [169796]
   Other proteins in same PDB: d2x1qa2, d2x1qb2
   automated match to d1ol0a_

Details for d2x1qa1

PDB Entry: 2x1q, 1.06 Å

PDB Description: gelsolin nanobody

PDB Compounds: (A:) gelsolin nanobody

SCOPe Domain Sequences for d2x1qa1:

Sequence, based on SEQRES records:

>d2x1qa1 b.1.1.1 (A:6-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgrtfsnyrmgwfrqapgkerefvatisqsgaatayadsvk
grftfsrdnaknllylemlslepedtavyycaassrvfytevlqtttgydywgqgtqvtv
ss

Sequence, based on observed residues (ATOM records):

>d2x1qa1 b.1.1.1 (A:6-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscasnyrmgwfrqapgkerefvatisqsgaatayadsvkgrftfs
rdnaknllylemlslepedtavyycaassrvfytevlqtttgydywgqgtqvtvss

Timeline for d2x1qa1:

• d2x1qa1 first appeared in SCOPe 2.01, called d2x1qa_
  
• d2x1qa1 appears in SCOPe 2.07