Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (19 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries) |
Domain d2x1oa_: 2x1o A: [169793] automated match to d1g9ea_ |
PDB Entry: 2x1o (more details), 1.34 Å
SCOPe Domain Sequences for d2x1oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x1oa_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlqesggglvqaggslrlscaaagrnlrmyrmgwfrqapgkerefvgtmvwssdtiyya dsvkgrfiisrdnakntvylqmnslkpedtavyycaagagwagtmtdynywgqgtqvtvs
Timeline for d2x1oa_: