SCOPe 2.01: Domain d2x1oa_: 2x1o A:

Lineage for d2x1oa_ (2x1o A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (12 PDB entries)

8. Domain d2x1oa_: 2x1o A: [169793]
   automated match to d1g9ea_

Details for d2x1oa_

PDB Entry: 2x1o, 1.34 Å

PDB Description: gelsolin nanobody

PDB Compounds: (A:) gelsolin nanobody

SCOPe Domain Sequences for d2x1oa_:

Sequence; same for both SEQRES and ATOM records:

>d2x1oa_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaaagrnlrmyrmgwfrqapgkerefvgtmvwssdtiyya
dsvkgrfiisrdnakntvylqmnslkpedtavyycaagagwagtmtdynywgqgtqvtvs

Timeline for d2x1oa_:

• d2x1oa_ is new in SCOPe 2.01-stable
  
• d2x1oa_ appears in SCOPe 2.02
  
• d2x1oa_ appears in the current release, SCOPe 2.08, called d2x1oa1