Lineage for d2x0sa3 (2x0s A:1-405)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041792Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1041793Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 1042013Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (1 protein)
  6. 1042014Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (3 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 1042026Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [75557] (1 PDB entry)
  8. 1042027Domain d2x0sa3: 2x0s A:1-405 [169776]
    Other proteins in same PDB: d2x0sa1, d2x0sa2

Details for d2x0sa3

PDB Entry: 2x0s (more details), 3 Å

PDB Description: 3.0 a resolution crystal structure of glycosomal pyruvate phosphate dikinase from trypanosoma brucei
PDB Compounds: (A:) pyruvate phosphate dikinase

SCOPe Domain Sequences for d2x0sa3:

Sequence, based on SEQRES records: (download)

>d2x0sa3 d.142.1.5 (A:1-405) Pyruvate phosphate dikinase, N-terminal domain {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vakkwvyyfgggnadgnknmkellggkganlaemvnlgipvppgftitteacktyqetet
ipqevadqvrenvsrvekemgakfgdpanpllfsvrsgaaasmpgmmdtvlnlglnkvtv
dawvrraprlerfvydsyrrfitmyadivmqvgredfeealsrmkerrgtkfdtdltasd
lkelcdgylelfelktgcsfpqdpvmqlfaaikavfrswgnpratiyrrmnnitgllgta
vnvqamvfgnindrsatgvafsrspstgenfffgeylvnaqgedvvagirtpqqinhsls
lrwakahgvgeeerrkrypsmeeampenyrllcdvrkrlenhyrdmqdleftvqdgrlwl
lqcrngkrtihaavriaidmvneglisreeavlridpyqvdhlmh

Sequence, based on observed residues (ATOM records): (download)

>d2x0sa3 d.142.1.5 (A:1-405) Pyruvate phosphate dikinase, N-terminal domain {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vakkwvyyfgggnadgnknmkellggkganlaemvnlgipvppgftitteacktyqetet
ipqevadqvrenvsrvekemgakfgdpanpllfsvrsgaaasmdtvlnlglnkvtvdawv
rraprlerfvydsyrrfitmyadivmqvgredfeealsrmkerrgtkfdtdltasdlkel
cdgylelfelktgcsfpqdpvmqlfaaikavfrswgnpratiyrrmnnitgllgtavnvq
amvfgnindrsatgvafsrspstgenfffgeylvnaqgedvvagirtpqqinhslslrwa
kahgvgeeerrkrypsmeeampenyrllcdvrkrlenhyrdmqdleftvqdgrlwllqcr
ngkrtihaavriaidmvneglisreeavlridpyqvdhlmh

SCOPe Domain Coordinates for d2x0sa3:

Click to download the PDB-style file with coordinates for d2x0sa3.
(The format of our PDB-style files is described here.)

Timeline for d2x0sa3: