SCOPe 2.08: Domain d2x0no1: 2x0n O:1-164,O:334-358

Lineage for d2x0no1 (2x0n O:1-164,O:334-358)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)

7. Species Trypanosoma brucei brucei, glycosome [TaxId:5702] [51808] (1 PDB entry)

8. Domain d2x0no1: 2x0n O:1-164,O:334-358 [169762]
   Other proteins in same PDB: d2x0na2, d2x0nb2, d2x0no2, d2x0np2, d2x0nq2, d2x0nr2
   complexed with nad, so4

Details for d2x0no1

PDB Entry: 2x0n, 3.2 Å

PDB Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma brucei determined from laue data

PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d2x0no1:

Sequence; same for both SEQRES and ATOM records:

>d2x0no1 c.2.1.3 (O:1-164,O:334-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma brucei brucei, glycosome [TaxId: 5702]}
tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnasXnewgyshrvvdlvrh
maardraakl

Timeline for d2x0no1:

• d2x0no1 first appeared in SCOPe 2.01
  
• d2x0no1 appears in SCOPe 2.07