Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Malate dehydrogenase [51849] (13 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [110427] (2 PDB entries) Uniprot O08349 |
Domain d2x0ja1: 2x0j A:22-163 [169756] Other proteins in same PDB: d2x0ja2 complexed with ena, so4 |
PDB Entry: 2x0j (more details), 2.79 Å
SCOPe Domain Sequences for d2x0ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x0ja1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp mdvmtyimwkesgkprnevfgm
Timeline for d2x0ja1: