SCOPe 2.05: Domain d2x0ja1: 2x0j A:22-163

Lineage for d2x0ja1 (2x0j A:22-163)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [110427] (2 PDB entries)
   Uniprot O08349

8. Domain d2x0ja1: 2x0j A:22-163 [169756]
   Other proteins in same PDB: d2x0ja2
   complexed with ena, so4

Details for d2x0ja1

PDB Entry: 2x0j, 2.79 Å

PDB Description: 2.8 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with etheno-nad

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d2x0ja1:

Sequence; same for both SEQRES and ATOM records:

>d2x0ja1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg
gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp
mdvmtyimwkesgkprnevfgm

Timeline for d2x0ja1:

• d2x0ja1 first appeared in SCOPe 2.01
  
• d2x0ja1 appears in SCOPe 2.04
  
• d2x0ja1 appears in SCOPe 2.06
  
• d2x0ja1 appears in the current release, SCOPe 2.08