Lineage for d2x0ja1 (2x0j A:22-163)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 977429Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 977566Protein Malate dehydrogenase [51849] (12 species)
  7. 977571Species Archaeoglobus fulgidus [TaxId:2234] [110427] (2 PDB entries)
    Uniprot O08349
  8. 977573Domain d2x0ja1: 2x0j A:22-163 [169756]
    Other proteins in same PDB: d2x0ja2
    complexed with ena, so4

Details for d2x0ja1

PDB Entry: 2x0j (more details), 2.79 Å

PDB Description: 2.8 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with etheno-nad
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d2x0ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x0ja1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg
gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp
mdvmtyimwkesgkprnevfgm

SCOPe Domain Coordinates for d2x0ja1:

Click to download the PDB-style file with coordinates for d2x0ja1.
(The format of our PDB-style files is described here.)

Timeline for d2x0ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x0ja2