SCOPe 2.05: Domain d2x08a_: 2x08 A:

Lineage for d2x08a_ (2x08 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (9 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (24 PDB entries)

8. Domain d2x08a_: 2x08 A: [169752]
   automated match to d1koka_
   complexed with asc, hem

Details for d2x08a_

PDB Entry: 2x08, 2.01 Å

PDB Description: cytochrome c peroxidase: ascorbate bound to the engineered ascorbate binding site

PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2x08a_:

Sequence; same for both SEQRES and ATOM records:

>d2x08a_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tplvhvasvekgrsyedfqkvynaialklreddeadnyigygpvlvrlawhtsgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
lkrsgyegpfgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdrffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d2x08a_:

• d2x08a_ first appeared in SCOPe 2.01
  
• d2x08a_ appears in SCOPe 2.04
  
• d2x08a_ appears in SCOPe 2.06
  
• d2x08a_ appears in the current release, SCOPe 2.08