Lineage for d2x08a_ (2x08 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1496991Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1497288Protein automated matches [190089] (7 species)
    not a true protein
  7. 1497289Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (25 PDB entries)
  8. 1497311Domain d2x08a_: 2x08 A: [169752]
    automated match to d1koka_
    complexed with asc, hem

Details for d2x08a_

PDB Entry: 2x08 (more details), 2.01 Å

PDB Description: cytochrome c peroxidase: ascorbate bound to the engineered ascorbate binding site
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2x08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x08a_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tplvhvasvekgrsyedfqkvynaialklreddeadnyigygpvlvrlawhtsgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
lkrsgyegpfgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdrffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2x08a_:

Click to download the PDB-style file with coordinates for d2x08a_.
(The format of our PDB-style files is described here.)

Timeline for d2x08a_: