Lineage for d2wzza_ (2wzz A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1055110Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 1055111Protein automated matches [190857] (3 species)
    not a true protein
  7. 1055114Species Pseudomonas aeruginosa [TaxId:287] [189201] (6 PDB entries)
  8. 1055117Domain d2wzza_: 2wzz A: [169738]
    automated match to d1gcea_
    complexed with cl, zx1

Details for d2wzza_

PDB Entry: 2wzz (more details), 1.57 Å

PDB Description: amp-c beta-lactamase (pseudomonas aeruginosa)in complex with compound m-03
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2wzza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wzza_ e.3.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
apadrlkalvdaavqpvmkandipglavaislkgephyfsyglaskedgrrvtpetlfei
gsvsktftatlagyaltqdkmrlddrasqhwpalqgsrfdgislldlatytagglplqfp
dsvqkdqaqirdyyrqwqptyapgsqrlysnpsiglfgylaarslgqpferlmeqqvfpa
lgleqthldvpeaalaqyaqgygkddrplrvgpgpldaegygvktsaadllrfvdanlhp
erldrpwaqaldathrgyykvgdmtqglgweaydwpislkrlqagnstpmalqphriarl
papqalegqrllnktgstngfgayvafvpgrdlglvilanrnypnaervkiayailsgle

SCOPe Domain Coordinates for d2wzza_:

Click to download the PDB-style file with coordinates for d2wzza_.
(The format of our PDB-style files is described here.)

Timeline for d2wzza_: