Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (11 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (12 PDB entries) |
Domain d2wzpl_: 2wzp L: [169734] automated match to d1g9ea_ |
PDB Entry: 2wzp (more details), 2.6 Å
SCOPe Domain Sequences for d2wzpl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wzpl_ b.1.1.1 (L:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv ss
Timeline for d2wzpl_: