SCOPe 2.08: Domain d2wzpj1: 2wzp J:6-123

Lineage for d2wzpj1 (2wzp J:6-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d2wzpj1: 2wzp J:6-123 [169732]
   Other proteins in same PDB: d2wzpd2, d2wzpe2, d2wzpf2, d2wzpj2, d2wzpk2, d2wzpl2
   automated match to d1g9ea_

Details for d2wzpj1

PDB Entry: 2wzp, 2.6 Å

PDB Description: structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae

PDB Compounds: (J:) camelid vhh5

SCOPe Domain Sequences for d2wzpj1:

Sequence; same for both SEQRES and ATOM records:

>d2wzpj1 b.1.1.1 (J:6-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyyadsvk
grftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtvss

Timeline for d2wzpj1:

• d2wzpj1 first appeared in SCOPe 2.01, called d2wzpj_
  
• d2wzpj1 appears in SCOPe 2.07