SCOP 1.75: Domain d1eqfa2: 1eqf A:1498-1625

Lineage for d1eqfa2 (1eqf A:1498-1625)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (1 family)

5. Family a.29.2.1: Bromodomain [47371] (4 proteins)

6. Protein TAFII250 double bromodomain module [47377] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47378] (1 PDB entry)

8. Domain d1eqfa2: 1eqf A:1498-1625 [16973]
   complexed with so4

Details for d1eqfa2

PDB Entry: 1eqf, 2.1 Å

PDB Description: crystal structure of the double bromodomain module from human tafii250

PDB Compounds: (A:) RNA polymerase II transcription initiation factor

SCOP Domain Sequences for d1eqfa2:

Sequence; same for both SEQRES and ATOM records:

>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]}
llddddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkni
skhkyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekd
ictakeaa

Timeline for d1eqfa2:

• d1eqfa2 first appeared (with stable ids) in SCOP 1.55
  
• d1eqfa2 appears in SCOP 1.73
  
• d1eqfa2 appears in SCOPe 2.01
  
• d1eqfa2 appears in the current release, SCOPe 2.08