Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (31 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [189236] (2 PDB entries) |
Domain d2wzmb_: 2wzm B: [169728] automated match to d1mzra_ complexed with na7 |
PDB Entry: 2wzm (more details), 1.64 Å
SCOPe Domain Sequences for d2wzmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wzmb_ c.1.7.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} aiptvtlnddntlpvvgigvgelsdseaersvsaaleagyrlidtaaaygneaavgraia asgiprdeiyvttklatpdqgftssqaaaraslerlgldyvdlylihwpggdtskyvdsw gglmkvkedgiarsigvcnfgaedletivsltyftpavnqielhpllnqaalrevnagyn ivteaygplgvgrlldhpavtaiaeahgrtaaqvllrwsiqlgnvvisrsanperiasnl dvfgfeltademetlnglddgtrfrpdpatytgs
Timeline for d2wzmb_: