Lineage for d2wzmb_ (2wzm B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829673Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2829674Protein automated matches [190793] (31 species)
    not a true protein
  7. 2829770Species Mycobacterium smegmatis [TaxId:246196] [189236] (2 PDB entries)
  8. 2829772Domain d2wzmb_: 2wzm B: [169728]
    automated match to d1mzra_
    complexed with na7

Details for d2wzmb_

PDB Entry: 2wzm (more details), 1.64 Å

PDB Description: crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form
PDB Compounds: (B:) aldo-keto reductase

SCOPe Domain Sequences for d2wzmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wzmb_ c.1.7.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
aiptvtlnddntlpvvgigvgelsdseaersvsaaleagyrlidtaaaygneaavgraia
asgiprdeiyvttklatpdqgftssqaaaraslerlgldyvdlylihwpggdtskyvdsw
gglmkvkedgiarsigvcnfgaedletivsltyftpavnqielhpllnqaalrevnagyn
ivteaygplgvgrlldhpavtaiaeahgrtaaqvllrwsiqlgnvvisrsanperiasnl
dvfgfeltademetlnglddgtrfrpdpatytgs

SCOPe Domain Coordinates for d2wzmb_:

Click to download the PDB-style file with coordinates for d2wzmb_.
(The format of our PDB-style files is described here.)

Timeline for d2wzmb_: