Lineage for d1eqfa1 (1eqf A:1359-1497)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912955Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 912956Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 912957Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. 912979Protein TAFII250 double bromodomain module [47377] (1 species)
  7. 912980Species Human (Homo sapiens) [TaxId:9606] [47378] (1 PDB entry)
  8. 912981Domain d1eqfa1: 1eqf A:1359-1497 [16972]
    complexed with so4

Details for d1eqfa1

PDB Entry: 1eqf (more details), 2.1 Å

PDB Description: crystal structure of the double bromodomain module from human tafii250
PDB Compounds: (A:) RNA polymerase II transcription initiation factor

SCOPe Domain Sequences for d1eqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]}
gttvhcdylnrphksihrrrtdpmvtlssilesiindmrdlpntypfhtpvnakvvkdyy
kiitrpmdlqtlrenvrkrlypsreefrehlelivknsatyngpkhsltqisqsmldlcd
eklkekedklarlekainp

SCOPe Domain Coordinates for d1eqfa1:

Click to download the PDB-style file with coordinates for d1eqfa1.
(The format of our PDB-style files is described here.)

Timeline for d1eqfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eqfa2