Lineage for d1eqfa1 (1eqf A:1359-1497)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47212Fold a.29: Bromodomain-like [47363] (2 superfamilies)
  4. 47231Superfamily a.29.2: Bromodomain [47370] (1 family) (S)
  5. 47232Family a.29.2.1: Bromodomain [47371] (3 proteins)
  6. 47241Protein TAFII250 double bromodomain module [47377] (1 species)
  7. 47242Species Human (Homo sapiens) [TaxId:9606] [47378] (1 PDB entry)
  8. 47243Domain d1eqfa1: 1eqf A:1359-1497 [16972]

Details for d1eqfa1

PDB Entry: 1eqf (more details), 2.1 Å

PDB Description: crystal structure of the double bromodomain module from human tafii250

SCOP Domain Sequences for d1eqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens)}
gttvhcdylnrphksihrrrtdpmvtlssilesiindmrdlpntypfhtpvnakvvkdyy
kiitrpmdlqtlrenvrkrlypsreefrehlelivknsatyngpkhsltqisqsmldlcd
eklkekedklarlekainp

SCOP Domain Coordinates for d1eqfa1:

Click to download the PDB-style file with coordinates for d1eqfa1.
(The format of our PDB-style files is described here.)

Timeline for d1eqfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eqfa2