Lineage for d1e6ia_ (1e6i A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47212Fold a.29: Bromodomain-like [47363] (2 superfamilies)
  4. 47231Superfamily a.29.2: Bromodomain [47370] (1 family) (S)
  5. 47232Family a.29.2.1: Bromodomain [47371] (3 proteins)
  6. 47233Protein GCN5 [47372] (2 species)
  7. 47234Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47373] (1 PDB entry)
  8. 47235Domain d1e6ia_: 1e6i A: [16969]

Details for d1e6ia_

PDB Entry: 1e6i (more details), 1.87 Å

PDB Description: Bromodomain from GCN5 complexed with acetylated H4 peptide

SCOP Domain Sequences for d1e6ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae)}
rgphdaaiqniltelqnhaaawpflqpvnkeevpdyydfikepmdlstmeiklesnkyqk
medfiydarlvfnncrmyngentsyykyanrlekffnnkvkeipeyshlid

SCOP Domain Coordinates for d1e6ia_:

Click to download the PDB-style file with coordinates for d1e6ia_.
(The format of our PDB-style files is described here.)

Timeline for d1e6ia_: