SCOPe 2.05: Domain d2wx5l_: 2wx5 L:

Lineage for d2wx5l_ (2wx5 L:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (7 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)

8. Domain d2wx5l_: 2wx5 L: [169679]
   Other proteins in same PDB: d2wx5h1, d2wx5h2
   automated match to d1aigl_
   complexed with bcl, bph, cdl, fe, gol, hto, lda, na, spn, u10

Details for d2wx5l_

PDB Entry: 2wx5, 2.63 Å

PDB Description: hexa-coordination of a bacteriochlorophyll cofactor in the rhodobacter sphaeroides reaction centre

PDB Compounds: (L:) reaction centre protein l chain

SCOPe Domain Sequences for d2wx5l_:

Sequence; same for both SEQRES and ATOM records:

>d2wx5l_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
rtnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d2wx5l_:

• d2wx5l_ first appeared in SCOPe 2.01
  
• d2wx5l_ appears in SCOPe 2.04
  
• d2wx5l_ appears in SCOPe 2.06
  
• d2wx5l_ appears in the current release, SCOPe 2.08