Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein Succinate dehydrogenase subunit SdhC [82870] (1 species) Cytochrome b556 subunit |
Species Escherichia coli [TaxId:562] [82871] (8 PDB entries) |
Domain d2wu5c_: 2wu5 C: [169634] Other proteins in same PDB: d2wu5a1, d2wu5a2, d2wu5a3, d2wu5b1, d2wu5b2, d2wu5e1, d2wu5e2, d2wu5e3, d2wu5f1, d2wu5f2, d2wu5i1, d2wu5i2, d2wu5i3, d2wu5j1, d2wu5j2 automated match to d1nekc_ complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wu5 (more details), 2.8 Å
SCOPe Domain Sequences for d2wu5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu5c_ f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Escherichia coli [TaxId: 562]} qrpvnldlqtirfpitaiasilhrvsgvitfvavgillwllgtslsspegfeqasaimgs ffvkfimwgiltalayhvvvgirhmmmdfgyleetfeagkrsakisfvitvvlsllagvl vw
Timeline for d2wu5c_: